PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G1617
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 252aa    MW: 28949.5 Da    PI: 7.965
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G1617genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding621.2e-191360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed+ll ++v+++G g+W+++ar  g++R++k+c++rw +yl
      Gh_A07G1617 13 KGPWTPQEDKLLTEYVNMHGEGRWSSVARSSGLNRSGKSCRLRWVNYL 60
                     79********************************************97 PP

2Myb_DNA-binding51.52.2e-1666110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T++E+ +++++++++G++ W+tIar+++ gRt++++k++w+++
      Gh_A07G1617  66 RGQITPQEEGIIIELHALWGNK-WSTIARYLP-GRTDNEIKNYWRTH 110
                      7888******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.175864IPR017930Myb domain
SuperFamilySSF466893.67E-3210107IPR009057Homeodomain-like
SMARTSM007176.4E-171262IPR001005SANT/Myb domain
PfamPF002493.3E-181360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-241467IPR009057Homeodomain-like
CDDcd001678.25E-121560No hitNo description
SMARTSM007177.2E-1465113IPR001005SANT/Myb domain
PROSITE profilePS5129420.38565115IPR017930Myb domain
PfamPF002493.1E-1466110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2468114IPR009057Homeodomain-like
CDDcd001679.52E-1070110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MMGWEAPKIG LRKGPWTPQE DKLLTEYVNM HGEGRWSSVA RSSGLNRSGK SCRLRWVNYL  60
RPGLKRGQIT PQEEGIIIEL HALWGNKWST IARYLPGRTD NEIKNYWRTH YKKKEKSTLK  120
QQKRKAEILK LKQQQQQEKP DKDEGEDGKV NSEAVEITNH QSEGKQQMVF MYPSSEDQCL  180
AMMSQEPANA ASWIDQYLVD EGLWSGLWNL DDDHHQPGNC CNKIAMQSQA DTAYNNSFGG  240
DASNVYYGGY IF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25111145107B-MYB
1h8a_C5e-251111425127MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5846881e-66JX584688.1 Gossypium hirsutum clone NBRI_GE18056 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437969.11e-178PREDICTED: transcription factor MYB59-like
TrEMBLA0A0D2Q2521e-179A0A0D2Q252_G
STRINGSolyc02g089190.1.17e-83(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.14e-71myb domain protein 121